PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G301100.1
Common NameB456_009G301100, LOC105770643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 557aa    MW: 60463.6 Da    PI: 4.7629
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G301100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-174087148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Gorai.009G301100.1 40 KGPWTSAEDAILIDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                        79******************************************9986 PP

2Myb_DNA-binding56.18.7e-1893136146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T+eE++l++++++++G++ W++ a++m+ gRt++++k++w++
  Gorai.009G301100.1  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHMP-GRTDNEIKNYWNT 136
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0373587IPR017930Myb domain
SMARTSM007172.4E-153989IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-3039134IPR009057Homeodomain-like
PfamPF002492.4E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-244194IPR009057Homeodomain-like
CDDcd001676.41E-124287No hitNo description
PROSITE profilePS5129426.95888142IPR017930Myb domain
SMARTSM007171.3E-1792140IPR001005SANT/Myb domain
PfamPF002491.6E-1693136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2695141IPR009057Homeodomain-like
CDDcd001676.29E-1395136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSHTKHERED GMLSKDQTES PLIDDGSCGG GGAGGVVLKK GPWTSAEDAI LIDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HMPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVCLQALQE SHSTSVVNAL DKGPNDILQN  180
NSYEIPDVIF DSLKANQNVL PYVPELPVLS ASSMLMKGLG SSQYCGFMQP TIHRQKRLRE  240
SPAFFPGYTG AVKNECPLFM QFQEDISDKA AGSFGLSFPI EPDPAAKNSQ PFGVFPGSHT  300
LSNGNFSASE PPLEAVKLEL PSLQYPETEL GNWGTLTCPP PLLESVDAFI QSPPPTSGLE  360
SDSLSPRNSG LLDALLHEAK TLSSAKNHAS DKSSNSSTPG DIAEGSNFNI CETEWEKCGE  420
PLSPMGNSAT SIFSECISAS GSSLDEQPPA ETVTESHVKS EPADRVLTPE IQKEAPIRLD  480
SSGPDTLLAS NWLEQGSGYD KDQAILTDAI SSLLGDDLRS EYKNMEEGTS ISSQAWGLDS  540
CAWNNMPAVC QMSELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591467e-64AJ459146.1 Gossypium hirsutum partial myb118 gene, clone pGhMYB118.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447380.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012447381.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012447382.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012447383.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0D2UW460.0A0A0D2UW46_G
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-142myb domain protein 33
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]